Anti C4orf46 pAb (ATL-HPA047287)

Atlas Antibodies

Catalog No.:
ATL-HPA047287-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 46
Gene Name: C4orf46
Alternative Gene Name: LOC201725, RCDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027811: 94%, ENSRNOG00000010071: 94%
Entrez Gene ID: 201725
Uniprot ID: Q504U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Gene Sequence QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Gene ID - Mouse ENSMUSG00000027811
Gene ID - Rat ENSRNOG00000010071
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf46 pAb (ATL-HPA047287)
Datasheet Anti C4orf46 pAb (ATL-HPA047287) Datasheet (External Link)
Vendor Page Anti C4orf46 pAb (ATL-HPA047287) at Atlas Antibodies

Documents & Links for Anti C4orf46 pAb (ATL-HPA047287)
Datasheet Anti C4orf46 pAb (ATL-HPA047287) Datasheet (External Link)
Vendor Page Anti C4orf46 pAb (ATL-HPA047287)