Anti C4orf32 pAb (ATL-HPA069294)

Atlas Antibodies

Catalog No.:
ATL-HPA069294-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 32
Gene Name: C4orf32
Alternative Gene Name: FLJ39370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021194: 39%, ENSRNOG00000010875: 53%
Entrez Gene ID: 132720
Uniprot ID: Q8N8J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GERDEDGDALAEREAAGTEWDPGASPRRRGQRPKESEQDVEDSQN
Gene Sequence GERDEDGDALAEREAAGTEWDPGASPRRRGQRPKESEQDVEDSQN
Gene ID - Mouse ENSMUSG00000021194
Gene ID - Rat ENSRNOG00000010875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf32 pAb (ATL-HPA069294)
Datasheet Anti C4orf32 pAb (ATL-HPA069294) Datasheet (External Link)
Vendor Page Anti C4orf32 pAb (ATL-HPA069294) at Atlas Antibodies

Documents & Links for Anti C4orf32 pAb (ATL-HPA069294)
Datasheet Anti C4orf32 pAb (ATL-HPA069294) Datasheet (External Link)
Vendor Page Anti C4orf32 pAb (ATL-HPA069294)