Anti C4orf32 pAb (ATL-HPA062443)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062443-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C4orf32
Alternative Gene Name: FLJ39370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050549: 91%, ENSRNOG00000010875: 91%
Entrez Gene ID: 132720
Uniprot ID: Q8N8J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
Gene Sequence | NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
Gene ID - Mouse | ENSMUSG00000050549 |
Gene ID - Rat | ENSRNOG00000010875 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C4orf32 pAb (ATL-HPA062443) | |
Datasheet | Anti C4orf32 pAb (ATL-HPA062443) Datasheet (External Link) |
Vendor Page | Anti C4orf32 pAb (ATL-HPA062443) at Atlas Antibodies |
Documents & Links for Anti C4orf32 pAb (ATL-HPA062443) | |
Datasheet | Anti C4orf32 pAb (ATL-HPA062443) Datasheet (External Link) |
Vendor Page | Anti C4orf32 pAb (ATL-HPA062443) |