Anti C4orf3 pAb (ATL-HPA026907)
Atlas Antibodies
- SKU:
- ATL-HPA026907-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C4orf3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054091: 62%, ENSRNOG00000014654: 52%
Entrez Gene ID: 401152
Uniprot ID: Q8WVX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH |
Gene Sequence | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH |
Gene ID - Mouse | ENSMUSG00000054091 |
Gene ID - Rat | ENSRNOG00000014654 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C4orf3 pAb (ATL-HPA026907) | |
Datasheet | Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link) |
Vendor Page | Anti C4orf3 pAb (ATL-HPA026907) at Atlas Antibodies |
Documents & Links for Anti C4orf3 pAb (ATL-HPA026907) | |
Datasheet | Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link) |
Vendor Page | Anti C4orf3 pAb (ATL-HPA026907) |