Anti C4orf3 pAb (ATL-HPA026907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026907-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C4orf3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054091: 62%, ENSRNOG00000014654: 52%
Entrez Gene ID: 401152
Uniprot ID: Q8WVX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH |
| Gene Sequence | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH |
| Gene ID - Mouse | ENSMUSG00000054091 |
| Gene ID - Rat | ENSRNOG00000014654 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C4orf3 pAb (ATL-HPA026907) | |
| Datasheet | Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link) |
| Vendor Page | Anti C4orf3 pAb (ATL-HPA026907) at Atlas Antibodies |
| Documents & Links for Anti C4orf3 pAb (ATL-HPA026907) | |
| Datasheet | Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link) |
| Vendor Page | Anti C4orf3 pAb (ATL-HPA026907) |