Anti C4orf3 pAb (ATL-HPA026907)

Atlas Antibodies

Catalog No.:
ATL-HPA026907-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 3
Gene Name: C4orf3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054091: 62%, ENSRNOG00000014654: 52%
Entrez Gene ID: 401152
Uniprot ID: Q8WVX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
Gene Sequence MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
Gene ID - Mouse ENSMUSG00000054091
Gene ID - Rat ENSRNOG00000014654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf3 pAb (ATL-HPA026907)
Datasheet Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link)
Vendor Page Anti C4orf3 pAb (ATL-HPA026907) at Atlas Antibodies

Documents & Links for Anti C4orf3 pAb (ATL-HPA026907)
Datasheet Anti C4orf3 pAb (ATL-HPA026907) Datasheet (External Link)
Vendor Page Anti C4orf3 pAb (ATL-HPA026907)