Anti C4orf3 pAb (ATL-HPA026907)

Atlas Antibodies

Catalog No.: ATL-HPA026907-25

Protein Description: chromosome 4 open reading frame 3
Gene Name: C4orf3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054091: 62%, ENSRNOG00000014654: 52%
Entrez Gene ID: 401152
Uniprot ID: Q8WVX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
• Gene Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
• Gene ID - Mouse: ENSMUSG00000054091
• Gene ID - Rat: ENSRNOG00000014654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.