Anti C4orf22 pAb (ATL-HPA043383 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043383-25
  • Immunohistochemical staining of human fallopian tube shows moderate membrane positivity in ciliated cells.
  • Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C4orf22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407318).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 22
Gene Name: C4orf22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057816: 88%, ENSRNOG00000054400: 31%
Entrez Gene ID: 255119
Uniprot ID: Q6V702
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLTSAGK
Gene Sequence QEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLTSAGK
Gene ID - Mouse ENSMUSG00000057816
Gene ID - Rat ENSRNOG00000054400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C4orf22 pAb (ATL-HPA043383 w/enhanced validation)
Datasheet Anti C4orf22 pAb (ATL-HPA043383 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C4orf22 pAb (ATL-HPA043383 w/enhanced validation)