Anti C4orf19 pAb (ATL-HPA052894)

Atlas Antibodies

Catalog No.:
ATL-HPA052894-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 4 open reading frame 19
Gene Name: C4orf19
Alternative Gene Name: FLJ11017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060512: 51%, ENSRNOG00000002191: 51%
Entrez Gene ID: 55286
Uniprot ID: Q8IY42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
Gene Sequence TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH
Gene ID - Mouse ENSMUSG00000060512
Gene ID - Rat ENSRNOG00000002191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4orf19 pAb (ATL-HPA052894)
Datasheet Anti C4orf19 pAb (ATL-HPA052894) Datasheet (External Link)
Vendor Page Anti C4orf19 pAb (ATL-HPA052894) at Atlas Antibodies

Documents & Links for Anti C4orf19 pAb (ATL-HPA052894)
Datasheet Anti C4orf19 pAb (ATL-HPA052894) Datasheet (External Link)
Vendor Page Anti C4orf19 pAb (ATL-HPA052894)