Anti C4orf19 pAb (ATL-HPA052894)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052894-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C4orf19
Alternative Gene Name: FLJ11017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060512: 51%, ENSRNOG00000002191: 51%
Entrez Gene ID: 55286
Uniprot ID: Q8IY42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH |
| Gene Sequence | TQDDRGSWASTANTVPPTQPFLEGGGTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKNH |
| Gene ID - Mouse | ENSMUSG00000060512 |
| Gene ID - Rat | ENSRNOG00000002191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C4orf19 pAb (ATL-HPA052894) | |
| Datasheet | Anti C4orf19 pAb (ATL-HPA052894) Datasheet (External Link) |
| Vendor Page | Anti C4orf19 pAb (ATL-HPA052894) at Atlas Antibodies |
| Documents & Links for Anti C4orf19 pAb (ATL-HPA052894) | |
| Datasheet | Anti C4orf19 pAb (ATL-HPA052894) Datasheet (External Link) |
| Vendor Page | Anti C4orf19 pAb (ATL-HPA052894) |