Anti C4BPB pAb (ATL-HPA051620)
Atlas Antibodies
- SKU:
- ATL-HPA051620-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C4BPB
Alternative Gene Name: C4BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026405: 36%, ENSRNOG00000004125: 71%
Entrez Gene ID: 725
Uniprot ID: P20851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR |
Gene Sequence | ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR |
Gene ID - Mouse | ENSMUSG00000026405 |
Gene ID - Rat | ENSRNOG00000004125 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C4BPB pAb (ATL-HPA051620) | |
Datasheet | Anti C4BPB pAb (ATL-HPA051620) Datasheet (External Link) |
Vendor Page | Anti C4BPB pAb (ATL-HPA051620) at Atlas Antibodies |
Documents & Links for Anti C4BPB pAb (ATL-HPA051620) | |
Datasheet | Anti C4BPB pAb (ATL-HPA051620) Datasheet (External Link) |
Vendor Page | Anti C4BPB pAb (ATL-HPA051620) |