Anti C4BPB pAb (ATL-HPA051620)

Atlas Antibodies

Catalog No.: ATL-HPA051620-25

Protein Description: complement component 4 binding protein, beta
Gene Name: C4BPB
Alternative Gene Name: C4BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026405: 36%, ENSRNOG00000004125: 71%
Entrez Gene ID: 725
Uniprot ID: P20851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
• Gene Sequence: ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
• Gene ID - Mouse: ENSMUSG00000026405
• Gene ID - Rat: ENSRNOG00000004125
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.