Anti C4BPB pAb (ATL-HPA051620)

Atlas Antibodies

Catalog No.:
ATL-HPA051620-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: complement component 4 binding protein, beta
Gene Name: C4BPB
Alternative Gene Name: C4BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026405: 36%, ENSRNOG00000004125: 71%
Entrez Gene ID: 725
Uniprot ID: P20851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
Gene Sequence ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
Gene ID - Mouse ENSMUSG00000026405
Gene ID - Rat ENSRNOG00000004125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C4BPB pAb (ATL-HPA051620)
Datasheet Anti C4BPB pAb (ATL-HPA051620) Datasheet (External Link)
Vendor Page Anti C4BPB pAb (ATL-HPA051620) at Atlas Antibodies

Documents & Links for Anti C4BPB pAb (ATL-HPA051620)
Datasheet Anti C4BPB pAb (ATL-HPA051620) Datasheet (External Link)
Vendor Page Anti C4BPB pAb (ATL-HPA051620)