Anti C4A pAb (ATL-HPA050103)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050103-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C4A
Alternative Gene Name: C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073418: 72%, ENSRNOG00000000443: 85%
Entrez Gene ID: 720
Uniprot ID: P0C0L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG |
| Gene Sequence | LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG |
| Gene ID - Mouse | ENSMUSG00000073418 |
| Gene ID - Rat | ENSRNOG00000000443 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C4A pAb (ATL-HPA050103) | |
| Datasheet | Anti C4A pAb (ATL-HPA050103) Datasheet (External Link) |
| Vendor Page | Anti C4A pAb (ATL-HPA050103) at Atlas Antibodies |
| Documents & Links for Anti C4A pAb (ATL-HPA050103) | |
| Datasheet | Anti C4A pAb (ATL-HPA050103) Datasheet (External Link) |
| Vendor Page | Anti C4A pAb (ATL-HPA050103) |
| Citations for Anti C4A pAb (ATL-HPA050103) – 1 Found |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |