Anti C3orf67 pAb (ATL-HPA069696)

Atlas Antibodies

SKU:
ATL-HPA069696-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 67
Gene Name: C3orf67
Alternative Gene Name: FLJ42117, FLJ42930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021747: 88%, ENSRNOG00000007206: 84%
Entrez Gene ID: 200844
Uniprot ID: Q6ZVT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDLVAFTSEIFKGAVFQSLDGIVVSANCKLRKIFTLKSKPQDTADKDAVYGVPFSTDEPTDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAE
Gene Sequence IDLVAFTSEIFKGAVFQSLDGIVVSANCKLRKIFTLKSKPQDTADKDAVYGVPFSTDEPTDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAE
Gene ID - Mouse ENSMUSG00000021747
Gene ID - Rat ENSRNOG00000007206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C3orf67 pAb (ATL-HPA069696)
Datasheet Anti C3orf67 pAb (ATL-HPA069696) Datasheet (External Link)
Vendor Page Anti C3orf67 pAb (ATL-HPA069696) at Atlas Antibodies

Documents & Links for Anti C3orf67 pAb (ATL-HPA069696)
Datasheet Anti C3orf67 pAb (ATL-HPA069696) Datasheet (External Link)
Vendor Page Anti C3orf67 pAb (ATL-HPA069696)