Anti C3orf52 pAb (ATL-HPA011968)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011968-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C3orf52
Alternative Gene Name: FLJ23186, TTMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033187: 79%, ENSRNOG00000022136: 74%
Entrez Gene ID: 79669
Uniprot ID: Q5BVD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP |
Gene Sequence | LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP |
Gene ID - Mouse | ENSMUSG00000033187 |
Gene ID - Rat | ENSRNOG00000022136 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C3orf52 pAb (ATL-HPA011968) | |
Datasheet | Anti C3orf52 pAb (ATL-HPA011968) Datasheet (External Link) |
Vendor Page | Anti C3orf52 pAb (ATL-HPA011968) at Atlas Antibodies |
Documents & Links for Anti C3orf52 pAb (ATL-HPA011968) | |
Datasheet | Anti C3orf52 pAb (ATL-HPA011968) Datasheet (External Link) |
Vendor Page | Anti C3orf52 pAb (ATL-HPA011968) |