Anti C3orf52 pAb (ATL-HPA007678)

Atlas Antibodies

Catalog No.:
ATL-HPA007678-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 52
Gene Name: C3orf52
Alternative Gene Name: FLJ23186, TTMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033187: 50%, ENSRNOG00000022136: 47%
Entrez Gene ID: 79669
Uniprot ID: Q5BVD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK
Gene Sequence AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK
Gene ID - Mouse ENSMUSG00000033187
Gene ID - Rat ENSRNOG00000022136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf52 pAb (ATL-HPA007678)
Datasheet Anti C3orf52 pAb (ATL-HPA007678) Datasheet (External Link)
Vendor Page Anti C3orf52 pAb (ATL-HPA007678) at Atlas Antibodies

Documents & Links for Anti C3orf52 pAb (ATL-HPA007678)
Datasheet Anti C3orf52 pAb (ATL-HPA007678) Datasheet (External Link)
Vendor Page Anti C3orf52 pAb (ATL-HPA007678)