Anti C3orf49 pAb (ATL-HPA053582)

Atlas Antibodies

Catalog No.:
ATL-HPA053582-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 49
Gene Name: C3orf49
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030850: 23%, ENSRNOG00000027633: 62%
Entrez Gene ID:
Uniprot ID: Q96BT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAQPQLYLPEPFKIAYRKVGQCRRFQQLKKKNGSFKRKGIERWHRAVSTNLLKQNVLVPKEESSSDSDMGFHESQQNQKSNLKTKVK
Gene Sequence RAQPQLYLPEPFKIAYRKVGQCRRFQQLKKKNGSFKRKGIERWHRAVSTNLLKQNVLVPKEESSSDSDMGFHESQQNQKSNLKTKVK
Gene ID - Mouse ENSMUSG00000030850
Gene ID - Rat ENSRNOG00000027633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf49 pAb (ATL-HPA053582)
Datasheet Anti C3orf49 pAb (ATL-HPA053582) Datasheet (External Link)
Vendor Page Anti C3orf49 pAb (ATL-HPA053582) at Atlas Antibodies

Documents & Links for Anti C3orf49 pAb (ATL-HPA053582)
Datasheet Anti C3orf49 pAb (ATL-HPA053582) Datasheet (External Link)
Vendor Page Anti C3orf49 pAb (ATL-HPA053582)