Anti C3orf38 pAb (ATL-HPA034736)

Atlas Antibodies

SKU:
ATL-HPA034736-25
  • Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 38
Gene Name: C3orf38
Alternative Gene Name: MGC26717
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059920: 75%, ENSRNOG00000000720: 78%
Entrez Gene ID: 285237
Uniprot ID: Q5JPI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGLIRCPFVENTWKIKFINLKIMGESSLAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTG
Gene Sequence FGLIRCPFVENTWKIKFINLKIMGESSLAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTG
Gene ID - Mouse ENSMUSG00000059920
Gene ID - Rat ENSRNOG00000000720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C3orf38 pAb (ATL-HPA034736)
Datasheet Anti C3orf38 pAb (ATL-HPA034736) Datasheet (External Link)
Vendor Page Anti C3orf38 pAb (ATL-HPA034736) at Atlas Antibodies

Documents & Links for Anti C3orf38 pAb (ATL-HPA034736)
Datasheet Anti C3orf38 pAb (ATL-HPA034736) Datasheet (External Link)
Vendor Page Anti C3orf38 pAb (ATL-HPA034736)