Anti C3orf36 pAb (ATL-HPA046432)

Atlas Antibodies

Catalog No.:
ATL-HPA046432-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 36
Gene Name: C3orf36
Alternative Gene Name: FLJ22173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048154: 37%, ENSRNOG00000061499: 37%
Entrez Gene ID: 80111
Uniprot ID: Q3SXR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP
Gene Sequence PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP
Gene ID - Mouse ENSMUSG00000048154
Gene ID - Rat ENSRNOG00000061499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf36 pAb (ATL-HPA046432)
Datasheet Anti C3orf36 pAb (ATL-HPA046432) Datasheet (External Link)
Vendor Page Anti C3orf36 pAb (ATL-HPA046432) at Atlas Antibodies

Documents & Links for Anti C3orf36 pAb (ATL-HPA046432)
Datasheet Anti C3orf36 pAb (ATL-HPA046432) Datasheet (External Link)
Vendor Page Anti C3orf36 pAb (ATL-HPA046432)