Anti C3orf36 pAb (ATL-HPA046432)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046432-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C3orf36
Alternative Gene Name: FLJ22173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048154: 37%, ENSRNOG00000061499: 37%
Entrez Gene ID: 80111
Uniprot ID: Q3SXR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP |
Gene Sequence | PGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRLSPP |
Gene ID - Mouse | ENSMUSG00000048154 |
Gene ID - Rat | ENSRNOG00000061499 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C3orf36 pAb (ATL-HPA046432) | |
Datasheet | Anti C3orf36 pAb (ATL-HPA046432) Datasheet (External Link) |
Vendor Page | Anti C3orf36 pAb (ATL-HPA046432) at Atlas Antibodies |
Documents & Links for Anti C3orf36 pAb (ATL-HPA046432) | |
Datasheet | Anti C3orf36 pAb (ATL-HPA046432) Datasheet (External Link) |
Vendor Page | Anti C3orf36 pAb (ATL-HPA046432) |