Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA059199-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 22
Gene Name: C3orf22
Alternative Gene Name: MGC34728
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049694: 49%, ENSRNOG00000025934: 56%
Entrez Gene ID: 152065
Uniprot ID: Q8N5N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFT
Gene Sequence SSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFT
Gene ID - Mouse ENSMUSG00000049694
Gene ID - Rat ENSRNOG00000025934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation)
Datasheet Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation)
Datasheet Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation)
Citations for Anti C3orf22 pAb (ATL-HPA059199 w/enhanced validation) – 1 Found
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed