Anti C3orf18 pAb (ATL-HPA012105)

Atlas Antibodies

Catalog No.: ATL-HPA012105-25

Protein Description: chromosome 3 open reading frame 18
Gene Name: C3orf18
Alternative Gene Name: G20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037977: 92%, ENSRNOG00000015718: 94%
Entrez Gene ID: 51161
Uniprot ID: Q9UK00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
• Gene Sequence: KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
• Gene ID - Mouse: ENSMUSG00000037977
• Gene ID - Rat: ENSRNOG00000015718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.