Anti C3orf18 pAb (ATL-HPA012105)

Atlas Antibodies

Catalog No.:
ATL-HPA012105-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 18
Gene Name: C3orf18
Alternative Gene Name: G20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037977: 92%, ENSRNOG00000015718: 94%
Entrez Gene ID: 51161
Uniprot ID: Q9UK00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
Gene Sequence KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
Gene ID - Mouse ENSMUSG00000037977
Gene ID - Rat ENSRNOG00000015718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf18 pAb (ATL-HPA012105)
Datasheet Anti C3orf18 pAb (ATL-HPA012105) Datasheet (External Link)
Vendor Page Anti C3orf18 pAb (ATL-HPA012105) at Atlas Antibodies

Documents & Links for Anti C3orf18 pAb (ATL-HPA012105)
Datasheet Anti C3orf18 pAb (ATL-HPA012105) Datasheet (External Link)
Vendor Page Anti C3orf18 pAb (ATL-HPA012105)