Anti C3orf14 pAb (ATL-HPA048286)

Atlas Antibodies

Catalog No.:
ATL-HPA048286-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 3 open reading frame 14
Gene Name: C3orf14
Alternative Gene Name: HT021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033111: 71%, ENSRNOG00000039871: 71%
Entrez Gene ID: 57415
Uniprot ID: Q9HBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSL
Gene Sequence LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSL
Gene ID - Mouse ENSMUSG00000033111
Gene ID - Rat ENSRNOG00000039871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C3orf14 pAb (ATL-HPA048286)
Datasheet Anti C3orf14 pAb (ATL-HPA048286) Datasheet (External Link)
Vendor Page Anti C3orf14 pAb (ATL-HPA048286) at Atlas Antibodies

Documents & Links for Anti C3orf14 pAb (ATL-HPA048286)
Datasheet Anti C3orf14 pAb (ATL-HPA048286) Datasheet (External Link)
Vendor Page Anti C3orf14 pAb (ATL-HPA048286)