Anti C2orf91 pAb (ATL-HPA042517)

Atlas Antibodies

Catalog No.:
ATL-HPA042517-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 91
Gene Name: C2orf91
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032637: 31%, ENSRNOG00000017030: 33%
Entrez Gene ID: 400950
Uniprot ID: Q6ZV80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA
Gene Sequence ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA
Gene ID - Mouse ENSMUSG00000032637
Gene ID - Rat ENSRNOG00000017030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf91 pAb (ATL-HPA042517)
Datasheet Anti C2orf91 pAb (ATL-HPA042517) Datasheet (External Link)
Vendor Page Anti C2orf91 pAb (ATL-HPA042517) at Atlas Antibodies

Documents & Links for Anti C2orf91 pAb (ATL-HPA042517)
Datasheet Anti C2orf91 pAb (ATL-HPA042517) Datasheet (External Link)
Vendor Page Anti C2orf91 pAb (ATL-HPA042517)