Anti C2orf91 pAb (ATL-HPA042517)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042517-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: C2orf91
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032637: 31%, ENSRNOG00000017030: 33%
Entrez Gene ID: 400950
Uniprot ID: Q6ZV80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA | 
| Gene Sequence | ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA | 
| Gene ID - Mouse | ENSMUSG00000032637 | 
| Gene ID - Rat | ENSRNOG00000017030 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti C2orf91 pAb (ATL-HPA042517) | |
| Datasheet | Anti C2orf91 pAb (ATL-HPA042517) Datasheet (External Link) | 
| Vendor Page | Anti C2orf91 pAb (ATL-HPA042517) at Atlas Antibodies | 
| Documents & Links for Anti C2orf91 pAb (ATL-HPA042517) | |
| Datasheet | Anti C2orf91 pAb (ATL-HPA042517) Datasheet (External Link) | 
| Vendor Page | Anti C2orf91 pAb (ATL-HPA042517) | 
 
         
                            