Anti C2orf91 pAb (ATL-HPA042517)

Atlas Antibodies

Catalog No.: ATL-HPA042517-25

Protein Description: chromosome 2 open reading frame 91
Gene Name: C2orf91
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032637: 31%, ENSRNOG00000017030: 33%
Entrez Gene ID: 400950
Uniprot ID: Q6ZV80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA
• Gene Sequence: ALHCPFDFPQAPLRGRHTLSQVPNKGHEKASAVQLPEKQGTDQSRRGPTSAVTKA
• Gene ID - Mouse: ENSMUSG00000032637
• Gene ID - Rat: ENSRNOG00000017030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.