Anti C2orf71 pAb (ATL-HPA051819)

Atlas Antibodies

Catalog No.:
ATL-HPA051819-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 71
Gene Name: C2orf71
Alternative Gene Name: FLJ34931, RP54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044375: 50%, ENSRNOG00000008942: 42%
Entrez Gene ID: 388939
Uniprot ID: A6NGG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSS
Gene Sequence HSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSS
Gene ID - Mouse ENSMUSG00000044375
Gene ID - Rat ENSRNOG00000008942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf71 pAb (ATL-HPA051819)
Datasheet Anti C2orf71 pAb (ATL-HPA051819) Datasheet (External Link)
Vendor Page Anti C2orf71 pAb (ATL-HPA051819) at Atlas Antibodies

Documents & Links for Anti C2orf71 pAb (ATL-HPA051819)
Datasheet Anti C2orf71 pAb (ATL-HPA051819) Datasheet (External Link)
Vendor Page Anti C2orf71 pAb (ATL-HPA051819)