Anti C2orf71 pAb (ATL-HPA051819)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051819-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: C2orf71
Alternative Gene Name: FLJ34931, RP54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044375: 50%, ENSRNOG00000008942: 42%
Entrez Gene ID: 388939
Uniprot ID: A6NGG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSS |
| Gene Sequence | HSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSS |
| Gene ID - Mouse | ENSMUSG00000044375 |
| Gene ID - Rat | ENSRNOG00000008942 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C2orf71 pAb (ATL-HPA051819) | |
| Datasheet | Anti C2orf71 pAb (ATL-HPA051819) Datasheet (External Link) |
| Vendor Page | Anti C2orf71 pAb (ATL-HPA051819) at Atlas Antibodies |
| Documents & Links for Anti C2orf71 pAb (ATL-HPA051819) | |
| Datasheet | Anti C2orf71 pAb (ATL-HPA051819) Datasheet (External Link) |
| Vendor Page | Anti C2orf71 pAb (ATL-HPA051819) |