Anti C2orf68 pAb (ATL-HPA051143)

Atlas Antibodies

Catalog No.: ATL-HPA051143-25

Protein Description: chromosome 2 open reading frame 68
Gene Name: C2orf68
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108680: 83%, ENSRNOG00000011713: 86%
Entrez Gene ID: 388969
Uniprot ID: Q2NKX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ
• Gene Sequence: SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ
• Gene ID - Mouse: ENSMUSG00000108680
• Gene ID - Rat: ENSRNOG00000011713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.