Anti C2orf68 pAb (ATL-HPA051143)

Atlas Antibodies

Catalog No.:
ATL-HPA051143-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 68
Gene Name: C2orf68
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108680: 83%, ENSRNOG00000011713: 86%
Entrez Gene ID: 388969
Uniprot ID: Q2NKX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ
Gene Sequence SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ
Gene ID - Mouse ENSMUSG00000108680
Gene ID - Rat ENSRNOG00000011713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf68 pAb (ATL-HPA051143)
Datasheet Anti C2orf68 pAb (ATL-HPA051143) Datasheet (External Link)
Vendor Page Anti C2orf68 pAb (ATL-HPA051143) at Atlas Antibodies

Documents & Links for Anti C2orf68 pAb (ATL-HPA051143)
Datasheet Anti C2orf68 pAb (ATL-HPA051143) Datasheet (External Link)
Vendor Page Anti C2orf68 pAb (ATL-HPA051143)