Anti C2orf61 pAb (ATL-HPA052691)

Atlas Antibodies

SKU: ATL-HPA052691-25

• 

Protein Description: chromosome 2 open reading frame 61
Gene Name: C2orf61
Alternative Gene Name: FLJ40172
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036557: 67%, ENSRNOG00000040136: 68%
Entrez Gene ID: 285051
Uniprot ID: Q8N801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLL
• Gene Sequence: VGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLL
• Gene ID - Mouse: ENSMUSG00000036557
• Gene ID - Rat: ENSRNOG00000040136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.