Anti C2orf49 pAb (ATL-HPA043846)
Atlas Antibodies
- SKU:
- ATL-HPA043846-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C2orf49
Alternative Gene Name: asw, MGC5509
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010290: 91%, ENSRNOG00000016447: 91%
Entrez Gene ID: 79074
Uniprot ID: Q9BVC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL |
Gene Sequence | CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL |
Gene ID - Mouse | ENSMUSG00000010290 |
Gene ID - Rat | ENSRNOG00000016447 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C2orf49 pAb (ATL-HPA043846) | |
Datasheet | Anti C2orf49 pAb (ATL-HPA043846) Datasheet (External Link) |
Vendor Page | Anti C2orf49 pAb (ATL-HPA043846) at Atlas Antibodies |
Documents & Links for Anti C2orf49 pAb (ATL-HPA043846) | |
Datasheet | Anti C2orf49 pAb (ATL-HPA043846) Datasheet (External Link) |
Vendor Page | Anti C2orf49 pAb (ATL-HPA043846) |