Anti C2orf49 pAb (ATL-HPA043846)

Atlas Antibodies

Catalog No.:
ATL-HPA043846-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 49
Gene Name: C2orf49
Alternative Gene Name: asw, MGC5509
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010290: 91%, ENSRNOG00000016447: 91%
Entrez Gene ID: 79074
Uniprot ID: Q9BVC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL
Gene Sequence CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL
Gene ID - Mouse ENSMUSG00000010290
Gene ID - Rat ENSRNOG00000016447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf49 pAb (ATL-HPA043846)
Datasheet Anti C2orf49 pAb (ATL-HPA043846) Datasheet (External Link)
Vendor Page Anti C2orf49 pAb (ATL-HPA043846) at Atlas Antibodies

Documents & Links for Anti C2orf49 pAb (ATL-HPA043846)
Datasheet Anti C2orf49 pAb (ATL-HPA043846) Datasheet (External Link)
Vendor Page Anti C2orf49 pAb (ATL-HPA043846)