Anti C2orf42 pAb (ATL-HPA031841 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031841-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-C2orf42 antibody. Corresponding C2orf42 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 42
Gene Name: C2orf42
Alternative Gene Name: FLJ20558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046679: 95%, ENSRNOG00000017380: 97%
Entrez Gene ID: 54980
Uniprot ID: Q9NWW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVEVESIAETYGRIEKQPVLRPLELKTFLKVGNTSPDQKEPTPFIIEWIPDILPQSKIGELRIKFEYGHHRNGHVAEYQDQRPPLDQPLELAPLT
Gene Sequence KVEVESIAETYGRIEKQPVLRPLELKTFLKVGNTSPDQKEPTPFIIEWIPDILPQSKIGELRIKFEYGHHRNGHVAEYQDQRPPLDQPLELAPLT
Gene ID - Mouse ENSMUSG00000046679
Gene ID - Rat ENSRNOG00000017380
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C2orf42 pAb (ATL-HPA031841 w/enhanced validation)
Datasheet Anti C2orf42 pAb (ATL-HPA031841 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C2orf42 pAb (ATL-HPA031841 w/enhanced validation)