Anti C2orf42 pAb (ATL-HPA031840)

Atlas Antibodies

Catalog No.: ATL-HPA031840-100

Protein Description: chromosome 2 open reading frame 42
Gene Name: C2orf42
Alternative Gene Name: FLJ20558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046679: 100%, ENSRNOG00000017380: 98%
Entrez Gene ID: 54980
Uniprot ID: Q9NWW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHQTMHYQFDGKPEPLVFHIPQSFFDALQQRISIGSAKKRLPNSTTAFVRKDALPLGTFSKYTWHITNILQVKQILDTPEMPLEITRSFIQNRDGTY
• Gene Sequence: IHQTMHYQFDGKPEPLVFHIPQSFFDALQQRISIGSAKKRLPNSTTAFVRKDALPLGTFSKYTWHITNILQVKQILDTPEMPLEITRSFIQNRDGTY
• Gene ID - Mouse: ENSMUSG00000046679
• Gene ID - Rat: ENSRNOG00000017380
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.