Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008546-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 40
Gene Name: C2orf40
Alternative Gene Name: augurin, ECRG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026051: 84%, ENSRNOG00000023576: 85%
Entrez Gene ID: 84417
Uniprot ID: Q9H1Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD
Gene Sequence KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD
Gene ID - Mouse ENSMUSG00000026051
Gene ID - Rat ENSRNOG00000023576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation)
Datasheet Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation)
Datasheet Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation)
Citations for Anti C2orf40 pAb (ATL-HPA008546 w/enhanced validation) – 5 Found
Lee, Jisook; Dang, Xitong; Borboa, Alexandra; Coimbra, Raul; Baird, Andrew; Eliceiri, Brian P. Thrombin-processed Ecrg4 recruits myeloid cells and induces antitumorigenic inflammation. Neuro-Oncology. 2015;17(5):685-96.  PubMed
Baird, Andrew; Coimbra, Raul; Dang, Xitong; Lopez, Nicole; Lee, Jisook; Krzyzaniak, Michael; Winfield, Robert; Potenza, Bruce; Eliceiri, Brian P. Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages. Journal Of Leukocyte Biology. 2012;91(5):773-81.  PubMed
Porzionato, A; Rucinski, M; Macchi, V; Sarasin, G; Malendowicz, L K; De Caro, R. ECRG4 expression in normal rat tissues: expression study and literature review. European Journal Of Histochemistry : Ejh. 2015;59(2):2458.  PubMed
Podvin, Sonia; Miller, Miles C; Rossi, Ryan; Chukwueke, Jasmine; Donahue, John E; Johanson, Conrad E; Baird, Andrew; Stopa, Edward G. The Orphan C2orf40 Gene is a Neuroimmune Factor in Alzheimer's Disease. Jsm Alzheimer's Disease And Related Dementia. 3(1)  PubMed
Cabuzu, Daniela; Ramakrishnan, Suresh K; Moor, Matthias B; Harmacek, Dusan; Auberson, Muriel; Durussel, Fanny; Bonny, Olivier. Loss of Ecrg4 improves calcium oxalate nephropathy. Plos One. 17(10):e0275972.  PubMed