Anti C2orf16 pAb (ATL-HPA052136)

Atlas Antibodies

Catalog No.:
ATL-HPA052136-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 2 open reading frame 16
Gene Name: C2orf16
Alternative Gene Name: DKFZp434G118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044581: 67%, ENSRNOG00000049398: 70%
Entrez Gene ID: 84226
Uniprot ID: Q68DN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFGIPAELMEPSQSLPEKGPVTISQPSVVKNYIQRHTFYHGHKKRMALRIWTRGSTSSIIQQYSGTRVRIKKTNSTFNGISQEVIQ
Gene Sequence LFGIPAELMEPSQSLPEKGPVTISQPSVVKNYIQRHTFYHGHKKRMALRIWTRGSTSSIIQQYSGTRVRIKKTNSTFNGISQEVIQ
Gene ID - Mouse ENSMUSG00000044581
Gene ID - Rat ENSRNOG00000049398
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2orf16 pAb (ATL-HPA052136)
Datasheet Anti C2orf16 pAb (ATL-HPA052136) Datasheet (External Link)
Vendor Page Anti C2orf16 pAb (ATL-HPA052136) at Atlas Antibodies

Documents & Links for Anti C2orf16 pAb (ATL-HPA052136)
Datasheet Anti C2orf16 pAb (ATL-HPA052136) Datasheet (External Link)
Vendor Page Anti C2orf16 pAb (ATL-HPA052136)