Anti C2CD4C pAb (ATL-HPA055915)

Atlas Antibodies

SKU:
ATL-HPA055915-25
  • Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuropil.
  • Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C2 calcium-dependent domain containing 4C
Gene Name: C2CD4C
Alternative Gene Name: FAM148C, KIAA1957, NLF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045912: 88%, ENSRNOG00000008026: 86%
Entrez Gene ID: 126567
Uniprot ID: Q8TF44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES
Gene Sequence PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES
Gene ID - Mouse ENSMUSG00000045912
Gene ID - Rat ENSRNOG00000008026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C2CD4C pAb (ATL-HPA055915)
Datasheet Anti C2CD4C pAb (ATL-HPA055915) Datasheet (External Link)
Vendor Page Anti C2CD4C pAb (ATL-HPA055915) at Atlas Antibodies

Documents & Links for Anti C2CD4C pAb (ATL-HPA055915)
Datasheet Anti C2CD4C pAb (ATL-HPA055915) Datasheet (External Link)
Vendor Page Anti C2CD4C pAb (ATL-HPA055915)