Anti C2CD3 pAb (ATL-HPA040433)

Atlas Antibodies

Catalog No.:
ATL-HPA040433-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C2 calcium-dependent domain containing 3
Gene Name: C2CD3
Alternative Gene Name: DKFZP586P0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047248: 89%, ENSRNOG00000017608: 89%
Entrez Gene ID: 26005
Uniprot ID: Q4AC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLHVLLMVPDGKDFISGESEKQSPCNVYLNCKLFSTEEVTRSVIAWGTTQPVFNFSQVIPVSLSSKYLERLKNNVMVIETWNKVRSPGQDKLLGLVKLPLHQ
Gene Sequence LLLHVLLMVPDGKDFISGESEKQSPCNVYLNCKLFSTEEVTRSVIAWGTTQPVFNFSQVIPVSLSSKYLERLKNNVMVIETWNKVRSPGQDKLLGLVKLPLHQ
Gene ID - Mouse ENSMUSG00000047248
Gene ID - Rat ENSRNOG00000017608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C2CD3 pAb (ATL-HPA040433)
Datasheet Anti C2CD3 pAb (ATL-HPA040433) Datasheet (External Link)
Vendor Page Anti C2CD3 pAb (ATL-HPA040433) at Atlas Antibodies

Documents & Links for Anti C2CD3 pAb (ATL-HPA040433)
Datasheet Anti C2CD3 pAb (ATL-HPA040433) Datasheet (External Link)
Vendor Page Anti C2CD3 pAb (ATL-HPA040433)