Anti C2CD3 pAb (ATL-HPA038552)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038552-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C2CD3
Alternative Gene Name: DKFZP586P0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047248: 50%, ENSRNOG00000017608: 39%
Entrez Gene ID: 26005
Uniprot ID: Q4AC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASKARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKS |
| Gene Sequence | ELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASKARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKS |
| Gene ID - Mouse | ENSMUSG00000047248 |
| Gene ID - Rat | ENSRNOG00000017608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C2CD3 pAb (ATL-HPA038552) | |
| Datasheet | Anti C2CD3 pAb (ATL-HPA038552) Datasheet (External Link) |
| Vendor Page | Anti C2CD3 pAb (ATL-HPA038552) at Atlas Antibodies |
| Documents & Links for Anti C2CD3 pAb (ATL-HPA038552) | |
| Datasheet | Anti C2CD3 pAb (ATL-HPA038552) Datasheet (External Link) |
| Vendor Page | Anti C2CD3 pAb (ATL-HPA038552) |
| Citations for Anti C2CD3 pAb (ATL-HPA038552) – 3 Found |
| Tsai, Jhih-Jie; Hsu, Wen-Bin; Liu, Jia-Hua; Chang, Ching-Wen; Tang, Tang K. CEP120 interacts with C2CD3 and Talpid3 and is required for centriole appendage assembly and ciliogenesis. Scientific Reports. 2019;9(1):6037. PubMed |
| Evans, Lauren T; Anglen, Taylor; Scott, Phillip; Lukasik, Kimberly; Loncarek, Jadranka; Holland, Andrew J. ANKRD26 recruits PIDD1 to centriolar distal appendages to activate the PIDDosome following centrosome amplification. The Embo Journal. 2021;40(4):e105106. PubMed |
| Gaudin, Noémie; Martin Gil, Paula; Boumendjel, Meriem; Ershov, Dmitry; Pioche-Durieu, Catherine; Bouix, Manon; Delobelle, Quentin; Maniscalco, Lucia; Phan, Than Bich Ngan; Heyer, Vincent; Reina-San-Martin, Bernardo; Azimzadeh, Juliette. Evolutionary conservation of centriole rotational asymmetry in the human centrosome. Elife. 2022;11( 35319462) PubMed |