Anti C2CD3 pAb (ATL-HPA038552)

Atlas Antibodies

SKU: ATL-HPA038552-25

• 

Protein Description: C2 calcium-dependent domain containing 3
Gene Name: C2CD3
Alternative Gene Name: DKFZP586P0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047248: 50%, ENSRNOG00000017608: 39%
Entrez Gene ID: 26005
Uniprot ID: Q4AC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASKARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKS
• Gene Sequence: ELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASKARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKS
• Gene ID - Mouse: ENSMUSG00000047248
• Gene ID - Rat: ENSRNOG00000017608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C2CD3 pAb (ATL-HPA038552) – 3 Found

Tsai, Jhih-Jie; Hsu, Wen-Bin; Liu, Jia-Hua; Chang, Ching-Wen; Tang, Tang K. CEP120 interacts with C2CD3 and Talpid3 and is required for centriole appendage assembly and ciliogenesis. Scientific Reports. 2019;9(1):6037. 

Evans, Lauren T; Anglen, Taylor; Scott, Phillip; Lukasik, Kimberly; Loncarek, Jadranka; Holland, Andrew J. ANKRD26 recruits PIDD1 to centriolar distal appendages to activate the PIDDosome following centrosome amplification. The Embo Journal. 2021;40(4):e105106. 

Gaudin, Noémie; Martin Gil, Paula; Boumendjel, Meriem; Ershov, Dmitry; Pioche-Durieu, Catherine; Bouix, Manon; Delobelle, Quentin; Maniscalco, Lucia; Phan, Than Bich Ngan; Heyer, Vincent; Reina-San-Martin, Bernardo; Azimzadeh, Juliette. Evolutionary conservation of centriole rotational asymmetry in the human centrosome. Elife. 2022;11( 35319462)