Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030922-25
  • Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-C2CD2 antibody. Corresponding C2CD2 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C2 calcium-dependent domain containing 2
Gene Name: C2CD2
Alternative Gene Name: C21orf25, C21orf258, DKFZP586F0422, TMEM24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045975: 68%, ENSRNOG00000001621: 68%
Entrez Gene ID: 25966
Uniprot ID: Q9Y426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
Gene Sequence SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
Gene ID - Mouse ENSMUSG00000045975
Gene ID - Rat ENSRNOG00000001621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation)
Datasheet Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation)
Datasheet Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C2CD2 pAb (ATL-HPA030922 w/enhanced validation)