Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019531-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 22 open reading frame 42
Gene Name: C22orf42
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044033: 28%, ENSRNOG00000012580: 28%
Entrez Gene ID: 150297
Uniprot ID: Q6IC83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
Gene Sequence LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
Gene ID - Mouse ENSMUSG00000044033
Gene ID - Rat ENSRNOG00000012580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation)
Datasheet Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation)
Datasheet Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation)