Anti C22orf42 pAb (ATL-HPA019531 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019531-25

Protein Description: chromosome 22 open reading frame 42
Gene Name: C22orf42
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044033: 28%, ENSRNOG00000012580: 28%
Entrez Gene ID: 150297
Uniprot ID: Q6IC83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
• Gene Sequence: LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLR
• Gene ID - Mouse: ENSMUSG00000044033
• Gene ID - Rat: ENSRNOG00000012580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.