Anti C22orf39 pAb (ATL-HPA073701)

Atlas Antibodies

Catalog No.:
ATL-HPA073701-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 22 open reading frame 39
Gene Name: C22orf39
Alternative Gene Name: MGC74441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071632: 76%, ENSRNOG00000048861: 69%
Entrez Gene ID: 128977
Uniprot ID: Q6P5X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE
Gene Sequence AEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE
Gene ID - Mouse ENSMUSG00000071632
Gene ID - Rat ENSRNOG00000048861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C22orf39 pAb (ATL-HPA073701)
Datasheet Anti C22orf39 pAb (ATL-HPA073701) Datasheet (External Link)
Vendor Page Anti C22orf39 pAb (ATL-HPA073701) at Atlas Antibodies

Documents & Links for Anti C22orf39 pAb (ATL-HPA073701)
Datasheet Anti C22orf39 pAb (ATL-HPA073701) Datasheet (External Link)
Vendor Page Anti C22orf39 pAb (ATL-HPA073701)