Anti C22orf29 pAb (ATL-HPA000721)

Atlas Antibodies

SKU: ATL-HPA000721-25

• 
• 

Protein Description: chromosome 22 open reading frame 29
Gene Name: C22orf29
Alternative Gene Name: FLJ21125
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055745: 23%, ENSRNOG00000021671: 23%
Entrez Gene ID: 79680
Uniprot ID: Q7L3V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCP
• Gene Sequence: TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCP
• Gene ID - Mouse: ENSMUSG00000055745
• Gene ID - Rat: ENSRNOG00000021671
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.