Anti C22orf29 pAb (ATL-HPA000721)

Atlas Antibodies

Catalog No.:
ATL-HPA000721-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 22 open reading frame 29
Gene Name: C22orf29
Alternative Gene Name: FLJ21125
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055745: 23%, ENSRNOG00000021671: 23%
Entrez Gene ID: 79680
Uniprot ID: Q7L3V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCP
Gene Sequence TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCP
Gene ID - Mouse ENSMUSG00000055745
Gene ID - Rat ENSRNOG00000021671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C22orf29 pAb (ATL-HPA000721)
Datasheet Anti C22orf29 pAb (ATL-HPA000721) Datasheet (External Link)
Vendor Page Anti C22orf29 pAb (ATL-HPA000721) at Atlas Antibodies

Documents & Links for Anti C22orf29 pAb (ATL-HPA000721)
Datasheet Anti C22orf29 pAb (ATL-HPA000721) Datasheet (External Link)
Vendor Page Anti C22orf29 pAb (ATL-HPA000721)