Anti C21orf91 pAb (ATL-HPA049030)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049030-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C21orf91
Alternative Gene Name: C21orf14, C21orf38, CSSG1, EURL, YG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022864: 91%, ENSRNOG00000001554: 94%
Entrez Gene ID: 54149
Uniprot ID: Q9NYK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLS |
| Gene Sequence | EEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLS |
| Gene ID - Mouse | ENSMUSG00000022864 |
| Gene ID - Rat | ENSRNOG00000001554 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C21orf91 pAb (ATL-HPA049030) | |
| Datasheet | Anti C21orf91 pAb (ATL-HPA049030) Datasheet (External Link) |
| Vendor Page | Anti C21orf91 pAb (ATL-HPA049030) at Atlas Antibodies |
| Documents & Links for Anti C21orf91 pAb (ATL-HPA049030) | |
| Datasheet | Anti C21orf91 pAb (ATL-HPA049030) Datasheet (External Link) |
| Vendor Page | Anti C21orf91 pAb (ATL-HPA049030) |
| Citations for Anti C21orf91 pAb (ATL-HPA049030) – 1 Found |
| Reiche, Laura; Göttle, Peter; Lane, Lydie; Duek, Paula; Park, Mina; Azim, Kasum; Schütte, Jana; Manousi, Anastasia; Schira-Heinen, Jessica; Küry, Patrick. C21orf91 Regulates Oligodendroglial Precursor Cell Fate-A Switch in the Glial Lineage?. Frontiers In Cellular Neuroscience. 15( 33796011):653075. PubMed |