Anti C21orf91 pAb (ATL-HPA018288)

Atlas Antibodies

Catalog No.:
ATL-HPA018288-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 91
Gene Name: C21orf91
Alternative Gene Name: C21orf14, C21orf38, CSSG1, EURL, YG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022864: 80%, ENSRNOG00000001554: 79%
Entrez Gene ID: 54149
Uniprot ID: Q9NYK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLP
Gene Sequence CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLP
Gene ID - Mouse ENSMUSG00000022864
Gene ID - Rat ENSRNOG00000001554
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf91 pAb (ATL-HPA018288)
Datasheet Anti C21orf91 pAb (ATL-HPA018288) Datasheet (External Link)
Vendor Page Anti C21orf91 pAb (ATL-HPA018288) at Atlas Antibodies

Documents & Links for Anti C21orf91 pAb (ATL-HPA018288)
Datasheet Anti C21orf91 pAb (ATL-HPA018288) Datasheet (External Link)
Vendor Page Anti C21orf91 pAb (ATL-HPA018288)