Anti C21orf91 pAb (ATL-HPA018288)

Atlas Antibodies

Catalog No.: ATL-HPA018288-25

Protein Description: chromosome 21 open reading frame 91
Gene Name: C21orf91
Alternative Gene Name: C21orf14, C21orf38, CSSG1, EURL, YG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022864: 80%, ENSRNOG00000001554: 79%
Entrez Gene ID: 54149
Uniprot ID: Q9NYK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLP
• Gene Sequence: CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLP
• Gene ID - Mouse: ENSMUSG00000022864
• Gene ID - Rat: ENSRNOG00000001554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.