Anti C21orf59 pAb (ATL-HPA028849)
Atlas Antibodies
- SKU:
- ATL-HPA028849-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C21orf59
Alternative Gene Name: C21orf48, CILD26, FBB18, FLJ20467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022972: 95%, ENSRNOG00000021399: 93%
Entrez Gene ID: 56683
Uniprot ID: P57076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE |
| Gene Sequence | QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE |
| Gene ID - Mouse | ENSMUSG00000022972 |
| Gene ID - Rat | ENSRNOG00000021399 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C21orf59 pAb (ATL-HPA028849) | |
| Datasheet | Anti C21orf59 pAb (ATL-HPA028849) Datasheet (External Link) |
| Vendor Page | Anti C21orf59 pAb (ATL-HPA028849) at Atlas Antibodies |
| Documents & Links for Anti C21orf59 pAb (ATL-HPA028849) | |
| Datasheet | Anti C21orf59 pAb (ATL-HPA028849) Datasheet (External Link) |
| Vendor Page | Anti C21orf59 pAb (ATL-HPA028849) |
| Citations for Anti C21orf59 pAb (ATL-HPA028849) – 1 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |