Anti C21orf59 pAb (ATL-HPA028849)

Atlas Antibodies

Catalog No.:
ATL-HPA028849-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 59
Gene Name: C21orf59
Alternative Gene Name: C21orf48, CILD26, FBB18, FLJ20467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022972: 95%, ENSRNOG00000021399: 93%
Entrez Gene ID: 56683
Uniprot ID: P57076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE
Gene Sequence QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE
Gene ID - Mouse ENSMUSG00000022972
Gene ID - Rat ENSRNOG00000021399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf59 pAb (ATL-HPA028849)
Datasheet Anti C21orf59 pAb (ATL-HPA028849) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA028849) at Atlas Antibodies

Documents & Links for Anti C21orf59 pAb (ATL-HPA028849)
Datasheet Anti C21orf59 pAb (ATL-HPA028849) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA028849)
Citations for Anti C21orf59 pAb (ATL-HPA028849) – 1 Found
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed