Anti C21orf59 pAb (ATL-HPA019055)

Atlas Antibodies

Catalog No.:
ATL-HPA019055-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 59
Gene Name: C21orf59
Alternative Gene Name: C21orf48, CILD26, FBB18, FLJ20467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022972: 92%, ENSRNOG00000021399: 90%
Entrez Gene ID: 56683
Uniprot ID: P57076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNG
Gene Sequence GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNG
Gene ID - Mouse ENSMUSG00000022972
Gene ID - Rat ENSRNOG00000021399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf59 pAb (ATL-HPA019055)
Datasheet Anti C21orf59 pAb (ATL-HPA019055) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA019055) at Atlas Antibodies

Documents & Links for Anti C21orf59 pAb (ATL-HPA019055)
Datasheet Anti C21orf59 pAb (ATL-HPA019055) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA019055)
Citations for Anti C21orf59 pAb (ATL-HPA019055) – 1 Found
Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.  PubMed