Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018453-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 59
Gene Name: C21orf59
Alternative Gene Name: C21orf48, CILD26, FBB18, FLJ20467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022972: 89%, ENSRNOG00000021399: 89%
Entrez Gene ID: 56683
Uniprot ID: P57076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR
Gene Sequence GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR
Gene ID - Mouse ENSMUSG00000022972
Gene ID - Rat ENSRNOG00000021399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation)
Datasheet Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation)
Datasheet Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation)