Anti C21orf59 pAb (ATL-HPA018453 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018453-25

• 
• 

Protein Description: chromosome 21 open reading frame 59
Gene Name: C21orf59
Alternative Gene Name: C21orf48, CILD26, FBB18, FLJ20467
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022972: 89%, ENSRNOG00000021399: 89%
Entrez Gene ID: 56683
Uniprot ID: P57076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR
• Gene Sequence: GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR
• Gene ID - Mouse: ENSMUSG00000022972
• Gene ID - Rat: ENSRNOG00000021399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.