Anti C21orf58 pAb (ATL-HPA035110)

Atlas Antibodies

SKU:
ATL-HPA035110-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 58
Gene Name: C21orf58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009114: 44%, ENSRNOG00000012714: 46%
Entrez Gene ID: 54058
Uniprot ID: P58505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQR
Gene Sequence LQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQR
Gene ID - Mouse ENSMUSG00000009114
Gene ID - Rat ENSRNOG00000012714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C21orf58 pAb (ATL-HPA035110)
Datasheet Anti C21orf58 pAb (ATL-HPA035110) Datasheet (External Link)
Vendor Page Anti C21orf58 pAb (ATL-HPA035110) at Atlas Antibodies

Documents & Links for Anti C21orf58 pAb (ATL-HPA035110)
Datasheet Anti C21orf58 pAb (ATL-HPA035110) Datasheet (External Link)
Vendor Page Anti C21orf58 pAb (ATL-HPA035110)