Anti C21orf33 pAb (ATL-HPA018517)

Atlas Antibodies

Catalog No.: ATL-HPA018517-25

Protein Description: chromosome 21 open reading frame 33
Gene Name: C21orf33
Alternative Gene Name: D21S2048E, ES1, GT335, HES1, KNP-I, KNP-Ia, KNPH, KNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053329: 90%, ENSRNOG00000001211: 88%
Entrez Gene ID: 8209
Uniprot ID: P30042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN
• Gene Sequence: GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN
• Gene ID - Mouse: ENSMUSG00000053329
• Gene ID - Rat: ENSRNOG00000001211
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.