Anti C21orf33 pAb (ATL-HPA018517)

Atlas Antibodies

Catalog No.:
ATL-HPA018517-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 33
Gene Name: C21orf33
Alternative Gene Name: D21S2048E, ES1, GT335, HES1, KNP-I, KNP-Ia, KNPH, KNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053329: 90%, ENSRNOG00000001211: 88%
Entrez Gene ID: 8209
Uniprot ID: P30042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN
Gene Sequence GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN
Gene ID - Mouse ENSMUSG00000053329
Gene ID - Rat ENSRNOG00000001211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf33 pAb (ATL-HPA018517)
Datasheet Anti C21orf33 pAb (ATL-HPA018517) Datasheet (External Link)
Vendor Page Anti C21orf33 pAb (ATL-HPA018517) at Atlas Antibodies

Documents & Links for Anti C21orf33 pAb (ATL-HPA018517)
Datasheet Anti C21orf33 pAb (ATL-HPA018517) Datasheet (External Link)
Vendor Page Anti C21orf33 pAb (ATL-HPA018517)