Anti C21orf140 pAb (ATL-HPA045123)

Atlas Antibodies

Catalog No.:
ATL-HPA045123-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 140
Gene Name: C21orf140
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051728: 70%, ENSRNOG00000001986: 69%
Entrez Gene ID: 101928147
Uniprot ID: B9A014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRVF
Gene Sequence ASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRVF
Gene ID - Mouse ENSMUSG00000051728
Gene ID - Rat ENSRNOG00000001986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C21orf140 pAb (ATL-HPA045123)
Datasheet Anti C21orf140 pAb (ATL-HPA045123) Datasheet (External Link)
Vendor Page Anti C21orf140 pAb (ATL-HPA045123) at Atlas Antibodies

Documents & Links for Anti C21orf140 pAb (ATL-HPA045123)
Datasheet Anti C21orf140 pAb (ATL-HPA045123) Datasheet (External Link)
Vendor Page Anti C21orf140 pAb (ATL-HPA045123)