Anti C20orf24 pAb (ATL-HPA057387)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057387-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C20orf24
Alternative Gene Name: PNAS-11, RIP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027637: 97%, ENSRNOG00000020317: 97%
Entrez Gene ID: 55969
Uniprot ID: Q9BUV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF |
Gene Sequence | KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF |
Gene ID - Mouse | ENSMUSG00000027637 |
Gene ID - Rat | ENSRNOG00000020317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C20orf24 pAb (ATL-HPA057387) | |
Datasheet | Anti C20orf24 pAb (ATL-HPA057387) Datasheet (External Link) |
Vendor Page | Anti C20orf24 pAb (ATL-HPA057387) at Atlas Antibodies |
Documents & Links for Anti C20orf24 pAb (ATL-HPA057387) | |
Datasheet | Anti C20orf24 pAb (ATL-HPA057387) Datasheet (External Link) |
Vendor Page | Anti C20orf24 pAb (ATL-HPA057387) |