Anti C20orf24 pAb (ATL-HPA057387)

Atlas Antibodies

Catalog No.: ATL-HPA057387-25

Protein Description: chromosome 20 open reading frame 24
Gene Name: C20orf24
Alternative Gene Name: PNAS-11, RIP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027637: 97%, ENSRNOG00000020317: 97%
Entrez Gene ID: 55969
Uniprot ID: Q9BUV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
• Gene Sequence: KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
• Gene ID - Mouse: ENSMUSG00000027637
• Gene ID - Rat: ENSRNOG00000020317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.