Anti C20orf24 pAb (ATL-HPA057387)

Atlas Antibodies

Catalog No.:
ATL-HPA057387-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 20 open reading frame 24
Gene Name: C20orf24
Alternative Gene Name: PNAS-11, RIP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027637: 97%, ENSRNOG00000020317: 97%
Entrez Gene ID: 55969
Uniprot ID: Q9BUV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Gene Sequence KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Gene ID - Mouse ENSMUSG00000027637
Gene ID - Rat ENSRNOG00000020317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C20orf24 pAb (ATL-HPA057387)
Datasheet Anti C20orf24 pAb (ATL-HPA057387) Datasheet (External Link)
Vendor Page Anti C20orf24 pAb (ATL-HPA057387) at Atlas Antibodies

Documents & Links for Anti C20orf24 pAb (ATL-HPA057387)
Datasheet Anti C20orf24 pAb (ATL-HPA057387) Datasheet (External Link)
Vendor Page Anti C20orf24 pAb (ATL-HPA057387)