Anti C20orf202 pAb (ATL-HPA042786)

Atlas Antibodies

Catalog No.:
ATL-HPA042786-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 20 open reading frame 202
Gene Name: C20orf202
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019820: 28%, ENSRNOG00000020618: 27%
Entrez Gene ID: 400831
Uniprot ID: A1L168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL
Gene Sequence MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL
Gene ID - Mouse ENSMUSG00000019820
Gene ID - Rat ENSRNOG00000020618
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C20orf202 pAb (ATL-HPA042786)
Datasheet Anti C20orf202 pAb (ATL-HPA042786) Datasheet (External Link)
Vendor Page Anti C20orf202 pAb (ATL-HPA042786) at Atlas Antibodies

Documents & Links for Anti C20orf202 pAb (ATL-HPA042786)
Datasheet Anti C20orf202 pAb (ATL-HPA042786) Datasheet (External Link)
Vendor Page Anti C20orf202 pAb (ATL-HPA042786)