Anti C20orf202 pAb (ATL-HPA042786)

Atlas Antibodies

Catalog No.: ATL-HPA042786-25

Protein Description: chromosome 20 open reading frame 202
Gene Name: C20orf202
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019820: 28%, ENSRNOG00000020618: 27%
Entrez Gene ID: 400831
Uniprot ID: A1L168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL
• Gene Sequence: MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL
• Gene ID - Mouse: ENSMUSG00000019820
• Gene ID - Rat: ENSRNOG00000020618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.