Anti C20orf202 pAb (ATL-HPA042786)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042786-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C20orf202
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019820: 28%, ENSRNOG00000020618: 27%
Entrez Gene ID: 400831
Uniprot ID: A1L168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL |
Gene Sequence | MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL |
Gene ID - Mouse | ENSMUSG00000019820 |
Gene ID - Rat | ENSRNOG00000020618 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C20orf202 pAb (ATL-HPA042786) | |
Datasheet | Anti C20orf202 pAb (ATL-HPA042786) Datasheet (External Link) |
Vendor Page | Anti C20orf202 pAb (ATL-HPA042786) at Atlas Antibodies |
Documents & Links for Anti C20orf202 pAb (ATL-HPA042786) | |
Datasheet | Anti C20orf202 pAb (ATL-HPA042786) Datasheet (External Link) |
Vendor Page | Anti C20orf202 pAb (ATL-HPA042786) |