Anti C20orf196 pAb (ATL-HPA040749)

Atlas Antibodies

Catalog No.:
ATL-HPA040749-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 20 open reading frame 196
Gene Name: C20orf196
Alternative Gene Name: FLJ25067
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044991: 70%, ENSRNOG00000021268: 67%
Entrez Gene ID: 149840
Uniprot ID: Q8IYI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQES
Gene Sequence NNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQES
Gene ID - Mouse ENSMUSG00000044991
Gene ID - Rat ENSRNOG00000021268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C20orf196 pAb (ATL-HPA040749)
Datasheet Anti C20orf196 pAb (ATL-HPA040749) Datasheet (External Link)
Vendor Page Anti C20orf196 pAb (ATL-HPA040749) at Atlas Antibodies

Documents & Links for Anti C20orf196 pAb (ATL-HPA040749)
Datasheet Anti C20orf196 pAb (ATL-HPA040749) Datasheet (External Link)
Vendor Page Anti C20orf196 pAb (ATL-HPA040749)
Citations for Anti C20orf196 pAb (ATL-HPA040749) – 1 Found
Gao, Shengxian; Feng, Sumin; Ning, Shaokai; Liu, Jingyan; Zhao, Huayu; Xu, Yixi; Shang, Jinfeng; Li, Kejiao; Li, Qing; Guo, Rong; Xu, Dongyi. An OB-fold complex controls the repair pathways for DNA double-strand breaks. Nature Communications. 2018;9(1):3925.  PubMed