Anti C20orf194 pAb (ATL-HPA067418)

Atlas Antibodies

SKU: ATL-HPA067418-25

• 
• 

Protein Description: chromosome 20 open reading frame 194
Gene Name: C20orf194
Alternative Gene Name: DKFZp434N061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027309: 94%, ENSRNOG00000021237: 96%
Entrez Gene ID: 25943
Uniprot ID: Q5TEA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE
• Gene Sequence: ECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVE
• Gene ID - Mouse: ENSMUSG00000027309
• Gene ID - Rat: ENSRNOG00000021237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.