Anti C1RL pAb (ATL-HPA011338)

Atlas Antibodies

Catalog No.:
ATL-HPA011338-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: complement component 1, r subcomponent-like
Gene Name: C1RL
Alternative Gene Name: C1r-LP, C1RL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038527: 84%, ENSRNOG00000011718: 81%
Entrez Gene ID: 51279
Uniprot ID: Q9NZP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Gene Sequence NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Gene ID - Mouse ENSMUSG00000038527
Gene ID - Rat ENSRNOG00000011718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1RL pAb (ATL-HPA011338)
Datasheet Anti C1RL pAb (ATL-HPA011338) Datasheet (External Link)
Vendor Page Anti C1RL pAb (ATL-HPA011338) at Atlas Antibodies

Documents & Links for Anti C1RL pAb (ATL-HPA011338)
Datasheet Anti C1RL pAb (ATL-HPA011338) Datasheet (External Link)
Vendor Page Anti C1RL pAb (ATL-HPA011338)