Anti C1RL pAb (ATL-HPA011338)

Atlas Antibodies

SKU: ATL-HPA011338-100

• 
• 
• 

Protein Description: complement component 1, r subcomponent-like
Gene Name: C1RL
Alternative Gene Name: C1r-LP, C1RL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038527: 84%, ENSRNOG00000011718: 81%
Entrez Gene ID: 51279
Uniprot ID: Q9NZP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
• Gene Sequence: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
• Gene ID - Mouse: ENSMUSG00000038527
• Gene ID - Rat: ENSRNOG00000011718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.