Anti C1R pAb (ATL-HPA001551 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA001551-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1R
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055172: 87%, ENSRNOG00000011796: 86%
Entrez Gene ID: 715
Uniprot ID: P00736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC |
Gene Sequence | PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC |
Gene ID - Mouse | ENSMUSG00000055172 |
Gene ID - Rat | ENSRNOG00000011796 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1R pAb (ATL-HPA001551 w/enhanced validation) | |
Datasheet | Anti C1R pAb (ATL-HPA001551 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C1R pAb (ATL-HPA001551 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C1R pAb (ATL-HPA001551 w/enhanced validation) | |
Datasheet | Anti C1R pAb (ATL-HPA001551 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C1R pAb (ATL-HPA001551 w/enhanced validation) |
Citations for Anti C1R pAb (ATL-HPA001551 w/enhanced validation) – 2 Found |
Dodig-Crnković, Tea; Hong, Mun-Gwan; Thomas, Cecilia Engel; Häussler, Ragna S; Bendes, Annika; Dale, Matilda; Edfors, Fredrik; Forsström, Björn; Magnusson, Patrik K E; Schuppe-Koistinen, Ina; Odeberg, Jacob; Fagerberg, Linn; Gummesson, Anders; Bergström, Göran; Uhlén, Mathias; Schwenk, Jochen M. Facets of individual-specific health signatures determined from longitudinal plasma proteome profiling. Ebiomedicine. 2020;57( 32629387):102854. PubMed |
Belmonte, Beatrice; Mangogna, Alessandro; Gulino, Alessandro; Cancila, Valeria; Morello, Gaia; Agostinis, Chiara; Bulla, Roberta; Ricci, Giuseppe; Fraggetta, Filippo; Botto, Marina; Garred, Peter; Tedesco, Francesco. Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic Placentae. Frontiers In Immunology. 13( 35711467):882298. PubMed |