Anti C1QTNF8 pAb (ATL-HPA056438)

Atlas Antibodies

Catalog No.:
ATL-HPA056438-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C1q and tumor necrosis factor related protein 8
Gene Name: C1QTNF8
Alternative Gene Name: CTRP8, UNQ5829
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017446: 56%, ENSRNOG00000003259: 56%
Entrez Gene ID: 390664
Uniprot ID: P60827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV
Gene Sequence ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV
Gene ID - Mouse ENSMUSG00000017446
Gene ID - Rat ENSRNOG00000003259
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QTNF8 pAb (ATL-HPA056438)
Datasheet Anti C1QTNF8 pAb (ATL-HPA056438) Datasheet (External Link)
Vendor Page Anti C1QTNF8 pAb (ATL-HPA056438) at Atlas Antibodies

Documents & Links for Anti C1QTNF8 pAb (ATL-HPA056438)
Datasheet Anti C1QTNF8 pAb (ATL-HPA056438) Datasheet (External Link)
Vendor Page Anti C1QTNF8 pAb (ATL-HPA056438)