Anti C1QTNF5 pAb (ATL-HPA038604)

Atlas Antibodies

SKU: ATL-HPA038604-25

• 

Protein Description: C1q and tumor necrosis factor related protein 5
Gene Name: C1QTNF5
Alternative Gene Name: CTRP5, DKFZp586B0621, LORD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079592: 90%, ENSRNOG00000007613: 92%
Entrez Gene ID: 114902
Uniprot ID: Q9BXJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQV
• Gene Sequence: ECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQV
• Gene ID - Mouse: ENSMUSG00000079592
• Gene ID - Rat: ENSRNOG00000007613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.