Anti C1QTNF5 pAb (ATL-HPA038604)

Atlas Antibodies

SKU:
ATL-HPA038604-25
  • Immunohistochemical staining of human nasopharynx shows moderate cytoplasmic positivity in respiratory epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C1q and tumor necrosis factor related protein 5
Gene Name: C1QTNF5
Alternative Gene Name: CTRP5, DKFZp586B0621, LORD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079592: 90%, ENSRNOG00000007613: 92%
Entrez Gene ID: 114902
Uniprot ID: Q9BXJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQV
Gene Sequence ECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQV
Gene ID - Mouse ENSMUSG00000079592
Gene ID - Rat ENSRNOG00000007613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1QTNF5 pAb (ATL-HPA038604)
Datasheet Anti C1QTNF5 pAb (ATL-HPA038604) Datasheet (External Link)
Vendor Page Anti C1QTNF5 pAb (ATL-HPA038604) at Atlas Antibodies

Documents & Links for Anti C1QTNF5 pAb (ATL-HPA038604)
Datasheet Anti C1QTNF5 pAb (ATL-HPA038604) Datasheet (External Link)
Vendor Page Anti C1QTNF5 pAb (ATL-HPA038604)