Anti C1QTNF4 pAb (ATL-HPA041032)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041032-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C1QTNF4
Alternative Gene Name: CTRP4, ZACRP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110961: 97%, ENSRNOG00000009140: 97%
Entrez Gene ID: 114900
Uniprot ID: Q9BXJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT |
| Gene Sequence | GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT |
| Gene ID - Mouse | ENSMUSG00000110961 |
| Gene ID - Rat | ENSRNOG00000009140 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1QTNF4 pAb (ATL-HPA041032) | |
| Datasheet | Anti C1QTNF4 pAb (ATL-HPA041032) Datasheet (External Link) |
| Vendor Page | Anti C1QTNF4 pAb (ATL-HPA041032) at Atlas Antibodies |
| Documents & Links for Anti C1QTNF4 pAb (ATL-HPA041032) | |
| Datasheet | Anti C1QTNF4 pAb (ATL-HPA041032) Datasheet (External Link) |
| Vendor Page | Anti C1QTNF4 pAb (ATL-HPA041032) |