Anti C1QTNF4 pAb (ATL-HPA041032)

Atlas Antibodies

Catalog No.:
ATL-HPA041032-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C1q and tumor necrosis factor related protein 4
Gene Name: C1QTNF4
Alternative Gene Name: CTRP4, ZACRP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110961: 97%, ENSRNOG00000009140: 97%
Entrez Gene ID: 114900
Uniprot ID: Q9BXJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
Gene Sequence GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
Gene ID - Mouse ENSMUSG00000110961
Gene ID - Rat ENSRNOG00000009140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QTNF4 pAb (ATL-HPA041032)
Datasheet Anti C1QTNF4 pAb (ATL-HPA041032) Datasheet (External Link)
Vendor Page Anti C1QTNF4 pAb (ATL-HPA041032) at Atlas Antibodies

Documents & Links for Anti C1QTNF4 pAb (ATL-HPA041032)
Datasheet Anti C1QTNF4 pAb (ATL-HPA041032) Datasheet (External Link)
Vendor Page Anti C1QTNF4 pAb (ATL-HPA041032)