Anti C1QTNF4 pAb (ATL-HPA041032)

Atlas Antibodies

Catalog No.: ATL-HPA041032-25

Protein Description: C1q and tumor necrosis factor related protein 4
Gene Name: C1QTNF4
Alternative Gene Name: CTRP4, ZACRP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110961: 97%, ENSRNOG00000009140: 97%
Entrez Gene ID: 114900
Uniprot ID: Q9BXJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
• Gene Sequence: GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
• Gene ID - Mouse: ENSMUSG00000110961
• Gene ID - Rat: ENSRNOG00000009140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.